AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGM5 Antibody
상품 한눈에 보기
인체 PGM5 단백질을 표적으로 하는 폴리클론 항체로, IHC 및 WB 분석에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인체에 높은 반응성을 보이며 Orthogonal validation으로 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067102-100 Anti-PGM5 Antibody, phosphoglucomutase 5 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067102-25 Anti-PGM5 Antibody, phosphoglucomutase 5 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGM5 Antibody
Anti-PGM5 Antibody
Target: phosphoglucomutase 5 (PGM5)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot)
Product Description
Polyclonal antibody against human PGM5.
Alternative Gene Names
PGMRP
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
KDGLWAVLVWLSIIAARKQSVEEIVRDHWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDS
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000041731 | 94% |
| Rat | ENSRNOG00000015406 | 89% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.