CacheBy
Atlas Antibodies Anti-PGP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGP Antibody

상품 한눈에 보기

Human PGP 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC 및 Western Blot에서 사용 가능. 재조합 발현 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 가짐.

카탈로그번호
HPA046739-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046739-100 Anti-PGP Antibody, phosphoglycolate phosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046739-25 Anti-PGP Antibody, phosphoglycolate phosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGP Antibody

Anti-PGP Antibody

Target: phosphoglycolate phosphatase (PGP)
Type: Polyclonal Antibody against Human PGP


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody raised in rabbit against human phosphoglycolate phosphatase (PGP).
Validated for use in IHC and WB.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein phosphoglycolate phosphatase
Target Gene PGP
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINP
Verified Species Reactivity Human
Interspecies Identity Mouse (98%), Rat (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.