Atlas Antibodies Anti-PGM2L1 Antibody

상품 한눈에 보기

인간 PGM2L1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 WB 분석에 적합하며 RNA-seq 데이터와의 정합 검증을 통해 높은 신뢰도 제공. 토끼 유래 IgG 항체로 PrEST 항원 기반 친화 정제 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA056995-100 Anti-PGM2L1 Antibody, phosphoglucomutase 2-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA056995-25 Anti-PGM2L1 Antibody, phosphoglucomutase 2-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: phosphoglucomutase 2-like 1
Supplier: Atlas Antibodies

IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot) – Suitable for protein detection in human samples.

Polyclonal antibody against Human PGM2L1.

BM32A, FLJ32029

항목	내용
Target Protein	phosphoglucomutase 2-like 1
Target Gene	PGM2L1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD
Verified Species Reactivity	Human
Interspecies Homology	Mouse (78%), Rat (77%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet