CacheBy
Atlas Antibodies Anti-PGM2L1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGM2L1 Antibody

상품 한눈에 보기

인간 PGM2L1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 WB 분석에 적합하며 RNA-seq 데이터와의 정합 검증을 통해 높은 신뢰도 제공. 토끼 유래 IgG 항체로 PrEST 항원 기반 친화 정제 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056995-100 Anti-PGM2L1 Antibody, phosphoglucomutase 2-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056995-25 Anti-PGM2L1 Antibody, phosphoglucomutase 2-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGM2L1 Antibody

Anti-PGM2L1 Antibody

Target Protein: phosphoglucomutase 2-like 1
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot) – Suitable for protein detection in human samples.

Product Description

Polyclonal antibody against Human PGM2L1.


Alternative Gene Names

BM32A, FLJ32029


Target Information

항목 내용
Target Protein phosphoglucomutase 2-like 1
Target Gene PGM2L1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence YLETMNITLKQQLVKVYEKYGYHISKTSYFLCYEPPTIKSIFERLRNFDSPKEYPKFCGTFAILHVRDVTTGYD
Verified Species Reactivity Human
Interspecies Homology Mouse (78%), Rat (77%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.