CacheBy
Atlas Antibodies Anti-PGM3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PGM3 Antibody

상품 한눈에 보기

Human PGM3 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 높은 특이성과 재현성을 보장합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제되었습니다. Human, Mouse, Rat 종에 반응합니다.

카탈로그번호
HPA029760-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029760-100 Anti-PGM3 Antibody, phosphoglucomutase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029760-25 Anti-PGM3 Antibody, phosphoglucomutase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PGM3 Antibody

Anti-PGM3 Antibody

Target: phosphoglucomutase 3 (PGM3)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Independent Validation
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PGM3


Alternative Gene Names

AGM1, DKFZP434B187, PAGM


Target Information

항목 내용
Target Protein phosphoglucomutase 3
Target Gene PGM3
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000056131 (93%), Rat ENSRNOG00000009515 (89%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGV

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference

Open Datasheet


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Independent Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.