Atlas Antibodies Anti-PGM3 Antibody

상품 한눈에 보기

Human PGM3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal 및 Independent validation을 통해 단백질 발현이 검증되었습니다. 고순도의 Affinity 정제 항체로 다양한 연구 응용에 사용 가능합니다.

카탈로그번호: HPA029759-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029759-100 Anti-PGM3 Antibody, phosphoglucomutase 3 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029759-25 Anti-PGM3 Antibody, phosphoglucomutase 3 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-PGM3 Antibody

Anti-PGM3 Antibody

Target: phosphoglucomutase 3 (PGM3)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
WB (Independent validation): 서로 다른 에피토프를 인식하는 독립 항체 간 비교를 통해 단백질 발현 검증

Product Description

Polyclonal antibody against Human PGM3

Alternative Gene Names

AGM1, DKFZP434B187, PAGM

Target Information

항목	내용
Target Protein	phosphoglucomutase 3
Target Gene	PGM3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KPPQGMEIKSNERCCSFDGDADRIVYYYHDADGHFHLIDGDKIATLISSFLKELLVEIGESLNIGVVQTAYANGSSTRYLEEVMKVPVYCTKTGV
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000056131 (93%), Rat ENSRNOG00000009515 (89%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)