Atlas Antibodies Anti-PGLS Antibody

상품 한눈에 보기

인간 PGLS(6-phosphogluconolactonase)를 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 생쥐 및 랫드와 높은 서열 상동성을 가짐.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA042032-100 Anti-PGLS Antibody, 6-phosphogluconolactonase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA042032-25 Anti-PGLS Antibody, 6-phosphogluconolactonase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: 6-phosphogluconolactonase (PGLS)
Host: Rabbit Polyclonal Antibody

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human PGLS (6-phosphogluconolactonase).

항목	내용
Target Protein	6-phosphogluconolactonase
Target Gene	PGLS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	YRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREQ
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000031807 (87%), Rat ENSRNOG00000018326 (86%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet