AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGLYRP2 Antibody
상품 한눈에 보기
인간 PGLYRP2 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산됨. 면역조직화학 등 다양한 연구 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 글리세롤 및 PBS 완충액에 보존.
- 카탈로그번호
- HPA043568-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043568-100 Anti-PGLYRP2 Antibody, peptidoglycan recognition protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043568-25 Anti-PGLYRP2 Antibody, peptidoglycan recognition protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGLYRP2 Antibody
Anti-PGLYRP2 Antibody
Target: Peptidoglycan recognition protein 2 (PGLYRP2)
Type: Polyclonal antibody against Human PGLYRP2
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody raised in rabbit against human peptidoglycan recognition protein 2 (PGLYRP2).
Alternative Gene Names
PGLYRPL, PGRP-L, PGRPL, tagL, tagL-alpha, tagl-beta, TAGL-like
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Peptidoglycan recognition protein 2 |
| Target Gene | PGLYRP2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | VWGTLVLLQRLEPVHLQLQCMSQEQLAQVAANATKEFTEAFLGCPAIHPRCRWGAAPYRGRPKLLQLPLGFLYVHHTYVP |
Species Reactivity
- Verified: Human
- Interspecies Information:
- Mouse ENSMUSG00000079563 (85%)
- Rat ENSRNOG00000042318 (81%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.