
원본
Atlas Antibodies Anti-PGGT1B Antibody
상품 한눈에 보기
Human PGGT1B 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에 반응합니다. 40% glycerol/PBS buffer로 안정화되어 있습니다.
- 카탈로그번호
- HPA030646-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA030646-100 Anti-PGGT1B Antibody, protein geranylgeranyltransferase type I, beta subunit 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030646-25 Anti-PGGT1B Antibody, protein geranylgeranyltransferase type I, beta subunit 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGGT1B Antibody
Anti-PGGT1B Antibody
Target: Protein geranylgeranyltransferase type I, beta subunit
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human PGGT1B.
Alternative Gene Names
BGGI, GGTI
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Protein geranylgeranyltransferase type I, beta subunit |
| Target Gene | PGGT1B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GAGLESHGGSTFCGIASLCLMGKLEEVFSEKELNRIKRWCIMRQQNGYHGRPNKPVDTCYSFWVGATLKLLKIFQYTNFEKNRNYILSTQDRLVGGFAKWPDSHPDALHAYFGICGLSLMEESGICKVHPALNVS |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Homology | Mouse ENSMUSG00000024477 (100%), Rat ENSRNOG00000003541 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.




