AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PGLS Antibody
상품 한눈에 보기
인간 PGLS 단백질을 인식하는 폴리클로날 토끼 항체로, WB, IHC, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 서열 보존성을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존되어 실험 재현성이 우수합니다.
- 카탈로그번호
- HPA040744-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040744-100 Anti-PGLS Antibody, 6-phosphogluconolactonase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040744-25 Anti-PGLS Antibody, 6-phosphogluconolactonase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PGLS Antibody
Anti-PGLS Antibody
Target Protein: 6-phosphogluconolactonase
Product Type: Polyclonal Antibody against Human PGLS
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent validation using antibodies targeting different epitopes
- Immunocytochemistry (ICC)
Alternative Gene Names
- 6PGL
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
YRTHLLSRLPIPESQVITINPELPVEEAAEDYAKKLRQAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQEREQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000031807 | 87% |
| Rat | ENSRNOG00000018326 | 86% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using PrEST antigen as ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.