CacheBy
Thermo Fisher Scientific GRPEL2 Polyclonal Antibody
원본

Thermo Fisher Scientific GRPEL2 Polyclonal Antibody

상품 한눈에 보기

GRPEL2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ELISA에 적합합니다. 인간, 마우스, 랫트 반응성을 가지며, 고순도 Affinity Chromatography 정제 제품입니다. -20°C 보관, 연구용 전용입니다.

카탈로그번호
PA5109790
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 03:48
Thermo Fisher Scientific PA5109790 GRPEL2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
627,600원VAT 포함 690,360원

Thermo Fisher Scientific · Thermo Fisher Scientific GRPEL2 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 1:500–1:2,000
Immunohistochemistry (Paraffin) (IHC (P)) 1:50–1:200
ELISA 1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 33–225 of human GRPEL2 (NP_689620.2)
Conjugate Unconjugated
Form Liquid
Concentration 2.68 mg/mL
Purification Affinity Chromatography
Storage Buffer PBS, pH 7.3, with 50% glycerol
Contains 0.02% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2855201

Product Specific Information

Immunogen sequence:
STATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQ RRL

Target Information

GRPEL2 (GrpE Like 2, Mitochondrial) is a protein-coding gene involved in mitochondrial protein import and metabolism of proteins.
Gene Ontology (GO) annotations include protein homodimerization activity and chaperone binding.
An important paralog of this gene is GRPEL1.
GRPEL2 is an essential component of the PAM complex, which mediates the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.
It regulates the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins, stimulates ATPase activity of mt-HSP70, and may modulate interconversion between oligomeric (inactive) and monomeric (active) forms of mt-HSP70.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.