Thermo Fisher Scientific GRPEL2 Polyclonal Antibody
GRPEL2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ELISA에 적합합니다. 인간, 마우스, 랫트 반응성을 가지며, 고순도 Affinity Chromatography 정제 제품입니다. -20°C 보관, 연구용 전용입니다.
- 카탈로그번호
- PA5109790
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific GRPEL2 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33–225 of human GRPEL2 (NP_689620.2) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.68 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2855201 |
Product Specific Information
Immunogen sequence:
STATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQ RRL
Target Information
GRPEL2 (GrpE Like 2, Mitochondrial) is a protein-coding gene involved in mitochondrial protein import and metabolism of proteins.
Gene Ontology (GO) annotations include protein homodimerization activity and chaperone binding.
An important paralog of this gene is GRPEL1.
GRPEL2 is an essential component of the PAM complex, which mediates the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.
It regulates the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins, stimulates ATPase activity of mt-HSP70, and may modulate interconversion between oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.