Thermo Fisher Scientific GRPEL2 Polyclonal Antibody
GRPEL2 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ELISA에 적합합니다. 인간, 마우스, 랫트 반응성을 가지며, 고순도 Affinity Chromatography 정제 제품입니다. -20°C 보관, 연구용 전용입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:500–1:2,000 |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:50–1:200 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 33–225 of human GRPEL2 (NP_689620.2) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.68 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2855201 |
Product Specific Information
Immunogen sequence:
STATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQ RRL
Target Information
GRPEL2 (GrpE Like 2, Mitochondrial) is a protein-coding gene involved in mitochondrial protein import and metabolism of proteins.
Gene Ontology (GO) annotations include protein homodimerization activity and chaperone binding.
An important paralog of this gene is GRPEL1.
GRPEL2 is an essential component of the PAM complex, which mediates the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner.
It regulates the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins, stimulates ATPase activity of mt-HSP70, and may modulate interconversion between oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific GRK1 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific GSDMB Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific GRPEL2 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific GPD1L Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific GNB3 Polyclonal Antibody
627,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|