Thermo Fisher Scientific hnRNP A1 Polyclonal Antibody
Human, Mouse, Rat에서 반응하는 Rabbit polyclonal anti-hnRNP A1 항체로 Western blot, IHC, ICC/IF, Flow cytometry 등에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 형태이며, 재구성 시 500 µg/mL 농도. 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific hnRNP A1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (IHC) | 2 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human hnRNP A1 (8–42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746497 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HnRNP A1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). These RNA-binding proteins complex with heterogeneous nuclear RNA (hnRNA) and are associated with pre-mRNAs in the nucleus, influencing pre-mRNA processing and mRNA metabolism and transport.
While all hnRNPs are nuclear, some shuttle between the nucleus and cytoplasm. hnRNP A1 contains two quasi-RRM domains that bind RNA and is one of the most abundant core proteins of hnRNP complexes, localized mainly to the nucleoplasm. Along with other hnRNP proteins, hnRNP A1 is exported from the nucleus bound to mRNA and rapidly re-imported.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific HOMER3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific hnRNP F Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific hnRNP A1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Haptoglobin Polyclonal Antibody
599,200원
Thermo Fisher Scientific
Thermo Fisher Scientific Heme oxygenase 2 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|