Thermo Fisher Scientific hnRNP A1 Polyclonal Antibody
Human, Mouse, Rat에서 반응하는 Rabbit polyclonal anti-hnRNP A1 항체로 Western blot, IHC, ICC/IF, Flow cytometry 등에 사용 가능. 항원 친화 크로마토그래피로 정제된 동결건조 형태이며, 재구성 시 500 µg/mL 농도. 연구용으로만 사용.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific hnRNP A1 Polyclonal Antibody
Thermo Fisher Scientific hnRNP A1 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (IHC) | 2 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human hnRNP A1 (8–42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746497 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
HnRNP A1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). These RNA-binding proteins complex with heterogeneous nuclear RNA (hnRNA) and are associated with pre-mRNAs in the nucleus, influencing pre-mRNA processing and mRNA metabolism and transport.
While all hnRNPs are nuclear, some shuttle between the nucleus and cytoplasm. hnRNP A1 contains two quasi-RRM domains that bind RNA and is one of the most abundant core proteins of hnRNP complexes, localized mainly to the nucleoplasm. Along with other hnRNP proteins, hnRNP A1 is exported from the nucleus bound to mRNA and rapidly re-imported.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.