CacheBy
Atlas Antibodies Anti-C22orf31 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C22orf31 Antibody

상품 한눈에 보기

인간 C22orf31 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 단백질 발현 검증 완료. 토끼 유래 IgG 항체이며, 친화 정제된 고품질 시약입니다. 40% 글리세롤 PBS 버퍼에 보존제로 나트륨 아지드가 포함되어 있습니다.

카탈로그번호
HPA000604-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA000604-100 Anti-C22orf31 Antibody, chromosome 22 open reading frame 31 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA000604-25 Anti-C22orf31 Antibody, chromosome 22 open reading frame 31 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C22orf31 Antibody

Anti-C22orf31 Antibody

Target: Chromosome 22 open reading frame 31
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human C22orf31.

Alternative Gene Names: bK747E2.1, HS747E2A
Target Protein: chromosome 22 open reading frame 31
Target Gene: C22orf31
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

LTVRQDLEDRYAEHVAATQALPQDSGTAAWKGRVLLPETQKRQQLSEDTLTIHGLPTEGYQALYHAVVEPMLWNPSGTPKRYSLELGKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000027230 25%
Mouse ENSMUSG00000040463 21%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)
Open Datasheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.