CacheBy
Atlas Antibodies Anti-C22orf29 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C22orf29 Antibody

상품 한눈에 보기

Human C22orf29 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 Western blot에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. PBS/glycerol 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA001419-100 Anti-C22orf29 Antibody, chromosome 22 open reading frame 29 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001419-25 Anti-C22orf29 Antibody, chromosome 22 open reading frame 29 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C22orf29 Antibody

Anti-C22orf29 Antibody

Target: chromosome 22 open reading frame 29 (C22orf29)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human C22orf29.


Alternative Gene Names

  • FLJ21125

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 22 open reading frame 29
Target Gene C22orf29
Verified Species Reactivity Human
Interspecies Identity Mouse (23%), Rat (23%)

Antigen Information

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TCGGKPAERGPLAGHMPSSRPHRVDFCWVPGSDPGTFDGSPWLLDRFLAQLGDYMSFHFEHYQDNISRVCEILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQDPNSFAEYHAVVTCP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2)
0.02% sodium azide added as preservative
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.