CacheBy
Atlas Antibodies Anti-C22orf39 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C22orf39 Antibody

상품 한눈에 보기

Human C22orf39 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 마우스 및 랫트와 교차 반응 가능성이 있음. 글리세롤 기반 완충액에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073701-100 Anti-C22orf39 Antibody, chromosome 22 open reading frame 39 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073701-25 Anti-C22orf39 Antibody, chromosome 22 open reading frame 39 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C22orf39 Antibody

Anti-C22orf39 Antibody

Target: chromosome 22 open reading frame 39 (C22orf39)
Type: Polyclonal Antibody against Human C22orf39


  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against the human C22orf39 protein.


Alternative Gene Names

  • MGC74441

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 22 open reading frame 39
Target Gene C22orf39
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AEAQQSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE

Verified Species Reactivity

  • Human

Interspecies Information
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000071632 (76%)
  • Rat ENSRNOG00000048861 (69%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.