
Atlas Antibodies Anti-C21orf59 Antibody
상품 한눈에 보기
인체 C21orf59 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 등 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 사람, 생쥐, 랫드 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C21orf59 Antibody
Target: chromosome 21 open reading frame 59
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot): Suitable for detection of C21orf59 protein.
Product Description
Polyclonal antibody against human C21orf59.
Alternative Gene Names
C21orf48, CILD26, FBB18, FLJ20467
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 21 open reading frame 59 |
| Target Gene | C21orf59 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000021399 (89%), Mouse ENSMUSG00000022972 (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimize conditions for each application. |
Material Safety Data Sheet
Open Datasheet
Antigen Sequence
GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C21orf58 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C21orf59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C21orf59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C21orf2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C21orf140 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.