
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C21orf59 Antibody
상품 한눈에 보기
인체 C21orf59 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 등 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원으로 친화 정제되었습니다. 사람, 생쥐, 랫드 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA019055-100 Anti-C21orf59 Antibody, chromosome 21 open reading frame 59 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019055-25 Anti-C21orf59 Antibody, chromosome 21 open reading frame 59 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C21orf59 Antibody
Anti-C21orf59 Antibody
Target: chromosome 21 open reading frame 59
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in high and low expression tissues.
- WB (Western Blot): Suitable for detection of C21orf59 protein.
Product Description
Polyclonal antibody against human C21orf59.
Alternative Gene Names
C21orf48, CILD26, FBB18, FLJ20467
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 21 open reading frame 59 |
| Target Gene | C21orf59 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000021399 (89%), Mouse ENSMUSG00000022972 (89%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimize conditions for each application. |
Material Safety Data Sheet
Open Datasheet
Antigen Sequence
GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



