CacheBy
Atlas Antibodies Anti-C21orf140 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C21orf140 Antibody

상품 한눈에 보기

인간 C21orf140 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산된 IgG 형태로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045123-100 Anti-C21orf140 Antibody, chromosome 21 open reading frame 140 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045123-25 Anti-C21orf140 Antibody, chromosome 21 open reading frame 140 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C21orf140 Antibody

Anti-C21orf140 Antibody

Target: Chromosome 21 open reading frame 140 (C21orf140)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C21orf140.

Open Datasheet

Target Information

항목 내용
Target Protein Chromosome 21 open reading frame 140
Target Gene C21orf140
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000051728 (70%), Rat ENSRNOG00000001986 (69%)

Antigen Sequence:
ASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTPTWCIVHAAGSQGWVPWKYRVF

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Recommended Applications: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.