
Atlas Antibodies Anti-C21orf140 Antibody
상품 한눈에 보기
인간 C21orf140 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산된 IgG 형태로, IHC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 버퍼에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C21orf140 Antibody
Target: Chromosome 21 open reading frame 140 (C21orf140)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human C21orf140.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 21 open reading frame 140 |
| Target Gene | C21orf140 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000051728 (70%), Rat ENSRNOG00000001986 (69%) |
Antigen Sequence:
ASPLLRNVIIRSQFDGIKRKQCLQYLKTLRTLQYDGFKTVYFGETNIPESLVTGEDISDGYFIQTPTWCIVHAAGSQGWVPWKYRVF
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C21orf59 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C21orf2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C21orf140 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C20orf96 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C20orf85 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.