CacheBy
Atlas Antibodies Anti-C21orf59 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C21orf59 Antibody

상품 한눈에 보기

Human C21orf59 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation으로 검증되었으며, 인간, 마우스, 랫트에 반응합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA018453-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018453-100 Anti-C21orf59 Antibody, chromosome 21 open reading frame 59 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018453-25 Anti-C21orf59 Antibody, chromosome 21 open reading frame 59 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C21orf59 Antibody

Anti-C21orf59 Antibody

Target: chromosome 21 open reading frame 59 (C21orf59)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of high and low expression tissues
  • WB (Western Blot)

Product Description

Polyclonal antibody against human C21orf59.


Alternative Gene Names

C21orf48, CILD26, FBB18, FLJ20467

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 21 open reading frame 59
Target Gene C21orf59
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GLNVIKEAEAQLWWAAKELRRTKKLSDYVGKNEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKR

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000022972 (89%)
  • Rat ENSRNOG00000021399 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.