
Atlas Antibodies Anti-C1orf56 Antibody
상품 한눈에 보기
Human C1orf56 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 Western Blot에서 검증된 Orthogonal 및 Recombinant Expression Validation 제공. Rabbit 호스트에서 생산되며 PrEST 항원으로 Affinity 정제. 인간 시료에 높은 특이성.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C1orf56 Antibody
Target: chromosome 1 open reading frame 56 (C1orf56)
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
- WB Recombinant Expression Validation: 타깃 단백질 과발현을 이용한 Western Blot 검증
Product Description
Polyclonal antibody against human C1orf56.
Alternative Gene Names
FLJ20519, MENT
Technical Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 1 open reading frame 56 |
| Target Gene | C1orf56 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence Detail | SSTRFIANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGSTPSRWPSPSPTAMPSPEDLRLVLMPWGPWHCHCKSGTMS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000021656 (71%), Mouse ENSMUSG00000068860 (66%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C1orf56 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf56 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf50 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf52 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.