Atlas Antibodies Anti-C1orf56 Antibody

상품 한눈에 보기

Human C1orf56 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 Western Blot에서 검증된 Orthogonal 및 Recombinant Expression Validation 제공. Rabbit 호스트에서 생산되며 PrEST 항원으로 Affinity 정제. 인간 시료에 높은 특이성.

카탈로그번호: HPA037429-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA037429-100 Anti-C1orf56 Antibody, chromosome 1 open reading frame 56 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA037429-25 Anti-C1orf56 Antibody, chromosome 1 open reading frame 56 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C1orf56 Antibody

Anti-C1orf56 Antibody

Target: chromosome 1 open reading frame 56 (C1orf56)
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation: 단백질 발현을 RNA-seq 데이터와 비교하여 고·저 발현 조직에서 검증
WB Recombinant Expression Validation: 타깃 단백질 과발현을 이용한 Western Blot 검증

Product Description

Polyclonal antibody against human C1orf56.

Alternative Gene Names

FLJ20519, MENT

Open Datasheet (PDF)

Technical Specifications

항목	내용
Target Protein	chromosome 1 open reading frame 56
Target Gene	C1orf56
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail	SSTRFIANSQEPEIRLTSSLPRSPGRSTEDLPGSQATLSQWSTPGSTPSRWPSPSPTAMPSPEDLRLVLMPWGPWHCHCKSGTMS
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000021656 (71%), Mouse ENSMUSG00000068860 (66%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.