CacheBy
Atlas Antibodies Anti-C1orf50 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf50 Antibody

상품 한눈에 보기

인간 C1orf50 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(재조합 발현 검증)에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 쥐, 생쥐와 86% 상동성 보유.

카탈로그번호
HPA030236-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030236-100 Anti-C1orf50 Antibody, chromosome 1 open reading frame 50 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030236-25 Anti-C1orf50 Antibody, chromosome 1 open reading frame 50 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf50 Antibody

Anti-C1orf50 Antibody

Target: chromosome 1 open reading frame 50 (C1orf50)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against Human C1orf50.

Alternative Gene Names

  • MGC955

Open Datasheet

Target Information

항목 내용
Target Protein chromosome 1 open reading frame 50
Target Gene C1orf50
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HHVACNIVKKPGNIYYLYKRESGQQYFSIISPKEWGTSCPHDFLGAYKLQHDLSWTPYEDIEKQDAKISMMDTLLSQSVALPPCTEPNFQGLTH
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000027455 (86%), Mouse ENSMUSG00000078584 (86%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

항목 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.