CacheBy
Atlas Antibodies Anti-C1orf53 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf53 Antibody

상품 한눈에 보기

인간 C1orf53 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원을 이용한 친화 정제 방식으로 제작. ICC 등 다양한 응용에 적합하며, 40% 글리세롤 및 PBS 완충액에 보존. 인간에 대해 검증됨.

카탈로그번호
HPA065352-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065352-100 Anti-C1orf53 Antibody, chromosome 1 open reading frame 53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065352-25 Anti-C1orf53 Antibody, chromosome 1 open reading frame 53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf53 Antibody

Anti-C1orf53 Antibody

Target Information

  • Target Protein: Chromosome 1 open reading frame 53
  • Target Gene: C1orf53
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    PPAPLWVRAGFRQQLSLTLCPANEGNCGGSAPSTPGRPERAARPSVS
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against human C1orf53.

Open Datasheet (PDF)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat (ENSRNOG00000043374) – 47%
  • Mouse (ENSMUSG00000079283) – 40%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.