CacheBy
Atlas Antibodies Anti-C1orf194 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf194 Antibody

상품 한눈에 보기

인간 C1orf194 단백질을 인식하는 토끼 폴리클로날 항체. IHC 기반 정량 검증 완료. PrEST 항원으로 친화 정제. 인간에 특이적 반응성 검증 완료. RNA-seq 데이터와 비교한 직교 검증으로 신뢰성 향상.

카탈로그번호
HPA049684-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049684-100 Anti-C1orf194 Antibody, chromosome 1 open reading frame 194 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049684-25 Anti-C1orf194 Antibody, chromosome 1 open reading frame 194 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf194 Antibody

Anti-C1orf194 Antibody

Chromosome 1 Open Reading Frame 194


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C1orf194.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chromosome 1 open reading frame 194
Target Gene C1orf194
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFK
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000027886 (64%), Rat ENSRNOG00000020307 (61%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation Icon
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.