
Atlas Antibodies Anti-C1orf194 Antibody
상품 한눈에 보기
인간 C1orf194 단백질을 인식하는 토끼 폴리클로날 항체. IHC 기반 정량 검증 완료. PrEST 항원으로 친화 정제. 인간에 특이적 반응성 검증 완료. RNA-seq 데이터와 비교한 직교 검증으로 신뢰성 향상.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C1orf194 Antibody
Chromosome 1 Open Reading Frame 194
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human C1orf194.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chromosome 1 open reading frame 194 |
| Target Gene | C1orf194 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MPPTRDPFQQPTLDNDDSYLGELRASKKLPYKNPTHLAQQQEPWSRLNSTPTITSMRRDAYYFDPEIPKDDLDFRLAALYNHHTGTFK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000027886 (64%), Rat ENSRNOG00000020307 (61%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C1orf204 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf198 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf194 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf174 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C1orf189 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.