CacheBy
Atlas Antibodies Anti-C1orf174 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf174 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-C1orf174 Antibody는 인간 C1orf174 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤 기반 PBS 버퍼에 보존제가 포함되어 안정적입니다.

카탈로그번호
HPA065778-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065778-100 Anti-C1orf174 Antibody, chromosome 1 open reading frame 174 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065778-25 Anti-C1orf174 Antibody, chromosome 1 open reading frame 174 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf174 Antibody

Anti-C1orf174 Antibody

Target: chromosome 1 open reading frame 174
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C1orf174.


Alternative Gene Names

  • RP13-531C17.2

Open Datasheet (PDF)


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VSDSRLAKTRDGLSVPKHSAGSGAEESNSSSTVQKQNEPGLQTEDVQKPPLQMDNSVFLDDDSNQPMPVSRFFGNVELMQDLPPASSSCPSMSRREFRKMHFRAKDDDDDDDDD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000025034 63%
Mouse ENSMUSG00000047613 63%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.