CacheBy
Atlas Antibodies Anti-C1orf204 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C1orf204 Antibody

상품 한눈에 보기

Human C1orf204 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, PBS와 글리세롤 완충액에 보존됩니다. 인간에 특이적으로 반응하며, 높은 품질의 연구용 항체입니다.

카탈로그번호
HPA045602-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045602-100 Anti-C1orf204 Antibody, chromosome 1 open reading frame 204 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045602-25 Anti-C1orf204 Antibody, chromosome 1 open reading frame 204 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C1orf204 Antibody

Anti-C1orf204 Antibody

Target: chromosome 1 open reading frame 204 (C1orf204)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C1orf204 protein.


Alternative Gene Names

  • FLJ39187

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 1 open reading frame 204
Target Gene C1orf204
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GLLVSSPHCEEPCAHSCAHPGLPPHLVHKLPLSYLQTQDTDAASRRINAPLAAGWSWLRLWLVT

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000014293 31%
Mouse ENSMUSG00000031661 29%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 내용
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.