CacheBy
Atlas Antibodies Anti-C17orf64 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C17orf64 Antibody

상품 한눈에 보기

Human C17orf64 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증됨. 재조합 단백질 기반 항원으로 제작되어 높은 특이성과 재현성을 제공. 인간 시료에 최적화되어 있으며, 글리세롤 보존 완충액 형태로 제공됨.

카탈로그번호
HPA044415-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044415-100 Anti-C17orf64 Antibody, chromosome 17 open reading frame 64 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044415-25 Anti-C17orf64 Antibody, chromosome 17 open reading frame 64 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C17orf64 Antibody

Anti-C17orf64 Antibody

Target: chromosome 17 open reading frame 64 (C17orf64)
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 교차 검증
  • WB (Recombinant Expression Validation): 표적 단백질 과발현을 이용한 재조합 발현 검증

Product Description

Polyclonal antibody against human C17orf64.
Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome 17 open reading frame 64
Target Gene C17orf64
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003143 (62%), Mouse ENSMUSG00000018479 (60%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.