
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C17orf64 Antibody
상품 한눈에 보기
Human C17orf64 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증됨. 재조합 단백질 기반 항원으로 제작되어 높은 특이성과 재현성을 제공. 인간 시료에 최적화되어 있으며, 글리세롤 보존 완충액 형태로 제공됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA044415-100 Anti-C17orf64 Antibody, chromosome 17 open reading frame 64 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044415-25 Anti-C17orf64 Antibody, chromosome 17 open reading frame 64 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C17orf64 Antibody
Anti-C17orf64 Antibody
Target: chromosome 17 open reading frame 64 (C17orf64)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 교차 검증
- WB (Recombinant Expression Validation): 표적 단백질 과발현을 이용한 재조합 발현 검증
Product Description
Polyclonal antibody against human C17orf64.
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 17 open reading frame 64 |
| Target Gene | C17orf64 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003143 (62%), Mouse ENSMUSG00000018479 (60%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



