
Atlas Antibodies Anti-C17orf64 Antibody
상품 한눈에 보기
Human C17orf64 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증됨. 재조합 단백질 기반 항원으로 제작되어 높은 특이성과 재현성을 제공. 인간 시료에 최적화되어 있으며, 글리세롤 보존 완충액 형태로 제공됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C17orf64 Antibody
Target: chromosome 17 open reading frame 64 (C17orf64)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직에서 교차 검증
- WB (Recombinant Expression Validation): 표적 단백질 과발현을 이용한 재조합 발현 검증
Product Description
Polyclonal antibody against human C17orf64.
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 17 open reading frame 64 |
| Target Gene | C17orf64 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LHSNISGMKERLSNMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000003143 (62%), Mouse ENSMUSG00000018479 (60%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C17orf80 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C17orf53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C17orf64 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C17orf67 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C17orf74 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.