CacheBy
Atlas Antibodies Anti-C17orf74 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C17orf74 Antibody

상품 한눈에 보기

인간 C17orf74 단백질을 인식하는 폴리클로날 항체로, IHC 등 다양한 응용에 적합함. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인간에 대한 반응성이 검증됨. 안정적인 PBS-글리세롤 버퍼에 보존됨.

카탈로그번호
HPA023649-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA023649-100 Anti-C17orf74 Antibody, chromosome 17 open reading frame 74 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023649-25 Anti-C17orf74 Antibody, chromosome 17 open reading frame 74 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C17orf74 Antibody

Anti-C17orf74 Antibody

Target: chromosome 17 open reading frame 74 (C17orf74)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human C17orf74.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 17 open reading frame 74
Target Gene C17orf74
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (74%, ENSRNOG00000058939), Mouse (74%, ENSMUSG00000044084)

Antigen Sequence:
LPPPSLYLSPELRCMPKRVEARSELRLQSYGRHGSQSRLWGNVEAEQWASSPPPPHRLPPNPSWVPVGHSPYPSVGWMLYDSWDQ


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Application - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.