AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C17orf53 Antibody
상품 한눈에 보기
Human C17orf53 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, IHC 및 ICC 실험에 적합. PrEST 항원으로 친화 정제된 고순도 제품. PBS/glycerol buffer에 보존되어 안정적이며, 인간에 대한 반응성이 검증됨.
- 카탈로그번호
- HPA024430-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA024430-100 Anti-C17orf53 Antibody, chromosome 17 open reading frame 53 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024430-25 Anti-C17orf53 Antibody, chromosome 17 open reading frame 53 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C17orf53 Antibody
Anti-C17orf53 Antibody
Target: chromosome 17 open reading frame 53 (C17orf53)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C17orf53.
Alternative Gene Names
- MGC3130
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 17 open reading frame 53 |
| Target Gene | C17orf53 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020908 (44%), Mouse ENSMUSG00000034773 (41%) |
Antigen Sequence
EQDEFDKVLASMELEEPGMELECGVSSEAIPILPAQQREGSVLAKKARVVDLSGSCQKGPVPAIHKAGIMSAQDESLDPVIQCRTPRPPLRPGAVGHLPVPTALTVPTQQLHWEVCPQRSPVQALQP
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.