
Atlas Antibodies Anti-C17orf100 Antibody
Human C17orf100 단백질을 인식하는 Rabbit Polyclonal 항체. 면역세포화학(ICC) 등 다양한 응용에 사용 가능. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공. 인간 대상 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C17orf100 Antibody
Target: chromosome 17 open reading frame 100 (C17orf100)
Type: Polyclonal Antibody against Human C17orf100
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human C17orf100 protein.
Alternative Gene Names
- LOC388327
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 17 open reading frame 100 |
| Target Gene | C17orf100 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (60%), Mouse (33%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QSSPRVGTTRYTETSTVRVETSSHRVETSSRRVETSQRRSEGPSLSPSGKRLPRILEASSRHVESSSQRTETTS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative.
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C16orf96 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf95 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C17orf100 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C16orf96 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C17ORF49 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|