Atlas Antibodies Anti-C16orf95 Antibody

상품 한눈에 보기

Human C16orf95 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 보이며, 마우스 및 랫과의 상동성 정보 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA067924-100 Anti-C16orf95 Antibody, chromosome 16 open reading frame 95 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA067924-25 Anti-C16orf95 Antibody, chromosome 16 open reading frame 95 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: chromosome 16 open reading frame 95 (C16orf95)
Type: Polyclonal Antibody against Human C16orf95

Polyclonal antibody raised in rabbit against human C16orf95 protein.
Open Datasheet

항목	내용
Target Protein	chromosome 16 open reading frame 95
Target Gene	C16orf95
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000031809 (40%), Rat ENSRNOG00000050028 (38%)

Antigen Sequence:

WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.

0개

로그인하시면 이 상품에 대해 문의를 남길 수 있어요.

아직 등록된 문의가 없어요.