CacheBy
Atlas Antibodies Anti-C16orf95 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C16orf95 Antibody

상품 한눈에 보기

Human C16orf95 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 보이며, 마우스 및 랫과의 상동성 정보 제공.

카탈로그번호
HPA067924-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA067924-100 Anti-C16orf95 Antibody, chromosome 16 open reading frame 95 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067924-25 Anti-C16orf95 Antibody, chromosome 16 open reading frame 95 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C16orf95 Antibody

Anti-C16orf95 Antibody

Target: chromosome 16 open reading frame 95 (C16orf95)
Type: Polyclonal Antibody against Human C16orf95

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody raised in rabbit against human C16orf95 protein.
Open Datasheet

Target Information

항목 내용
Target Protein chromosome 16 open reading frame 95
Target Gene C16orf95
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000031809 (40%), Rat ENSRNOG00000050028 (38%)

Antigen Sequence:

WAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGTTAGGSAVMSACCPSSSSS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.