CacheBy
Atlas Antibodies Anti-C17ORF49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C17ORF49 Antibody

상품 한눈에 보기

Human C17orf49 단백질을 인식하는 rabbit polyclonal antibody로 제작되었습니다. IHC, WB, ICC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 서열 일치도(98%)를 보여 인간, 마우스, 랫트 연구에 유용합니다.

카탈로그번호
HPA024457-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA024457-100 Anti-C17ORF49 Antibody, chromosome 17 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024457-25 Anti-C17ORF49 Antibody, chromosome 17 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C17ORF49 Antibody

Anti-C17orf49 Antibody

Target: chromosome 17 open reading frame 49
Product Type: Polyclonal Antibody against Human C17orf49


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is produced in rabbit against Human C17orf49. It is affinity purified using the PrEST antigen as ligand.


Alternative Gene Names

  • BAP18
  • HEPIS
  • MGC49942

Open Datasheet


Specifications

항목 내용
Target Protein chromosome 17 open reading frame 49
Target Gene C17orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000020831 (98%), Rat ENSRNOG00000018829 (98%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Antigen Sequence

TSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCVIKERTVAQIKATVKRKVYEDSGI


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.