
Atlas Antibodies Anti-C14orf93 Antibody
상품 한눈에 보기
Human C14orf93 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 높은 종간 보존성 보유. 40% glycerol 기반 buffer로 안정화 처리됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C14orf93 Antibody
Target: chromosome 14 open reading frame 93 (C14orf93)
Type: Polyclonal Antibody against Human C14orf93
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human C14orf93 protein. The antibody was affinity purified using the PrEST antigen as an affinity ligand.
Alternative Gene Names
- FLJ12154
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 14 open reading frame 93 |
| Target Gene | C14orf93 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DLRQGKVSIPDEDGESRAHSSPPEEPGPLKESPGEAFKALSAVEEECDSVGSGVQVVIEELRQLGAASVGPGPLGFPATQRDMRLPGCTLAASEAAPLLNPLVDDYVASEGAVQRVLVPAYAKQLSPATQLAIQRATPETGPENGTKL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022179 | 80% |
| Rat | ENSRNOG00000013317 | 79% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C15orf41 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf52 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C14orf93 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C15orf40 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.