CacheBy
Atlas Antibodies Anti-C14orf93 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C14orf93 Antibody

상품 한눈에 보기

Human C14orf93 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 높은 종간 보존성 보유. 40% glycerol 기반 buffer로 안정화 처리됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA002569-100 Anti-C14orf93 Antibody, chromosome 14 open reading frame 93 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002569-25 Anti-C14orf93 Antibody, chromosome 14 open reading frame 93 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C14orf93 Antibody

Anti-C14orf93 Antibody

Target: chromosome 14 open reading frame 93 (C14orf93)
Type: Polyclonal Antibody against Human C14orf93


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

This polyclonal antibody is raised in rabbit against the human C14orf93 protein. The antibody was affinity purified using the PrEST antigen as an affinity ligand.


Alternative Gene Names

  • FLJ12154

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 14 open reading frame 93
Target Gene C14orf93
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DLRQGKVSIPDEDGESRAHSSPPEEPGPLKESPGEAFKALSAVEEECDSVGSGVQVVIEELRQLGAASVGPGPLGFPATQRDMRLPGCTLAASEAAPLLNPLVDDYVASEGAVQRVLVPAYAKQLSPATQLAIQRATPETGPENGTKL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000022179 80%
Rat ENSRNOG00000013317 79%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.