
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C14orf93 Antibody
상품 한눈에 보기
Human C14orf93 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합. PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, 높은 종간 보존성 보유. 40% glycerol 기반 buffer로 안정화 처리됨.
- 카탈로그번호
- HPA002569-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA002569-100 Anti-C14orf93 Antibody, chromosome 14 open reading frame 93 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002569-25 Anti-C14orf93 Antibody, chromosome 14 open reading frame 93 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C14orf93 Antibody
Anti-C14orf93 Antibody
Target: chromosome 14 open reading frame 93 (C14orf93)
Type: Polyclonal Antibody against Human C14orf93
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
This polyclonal antibody is raised in rabbit against the human C14orf93 protein. The antibody was affinity purified using the PrEST antigen as an affinity ligand.
Alternative Gene Names
- FLJ12154
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 14 open reading frame 93 |
| Target Gene | C14orf93 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DLRQGKVSIPDEDGESRAHSSPPEEPGPLKESPGEAFKALSAVEEECDSVGSGVQVVIEELRQLGAASVGPGPLGFPATQRDMRLPGCTLAASEAAPLLNPLVDDYVASEGAVQRVLVPAYAKQLSPATQLAIQRATPETGPENGTKL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000022179 | 80% |
| Rat | ENSRNOG00000013317 | 79% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 설명 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



