CacheBy
Atlas Antibodies Anti-C15orf39 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C15orf39 Antibody

상품 한눈에 보기

인간 C15orf39 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼에서 생산된 IgG 형 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 특이적이며, 높은 종간 서열 일치율을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039961-100 Anti-C15orf39 Antibody, chromosome 15 open reading frame 39 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039961-25 Anti-C15orf39 Antibody, chromosome 15 open reading frame 39 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C15orf39 Antibody

Anti-C15orf39 Antibody

Target: chromosome 15 open reading frame 39 (C15orf39)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C15orf39.


Alternative Gene Names

  • DKFZP434H132
  • FLJ46337

Open Datasheet (PDF)


Target Information

  • Target Protein: chromosome 15 open reading frame 39
  • Target Gene: C15orf39
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
LCDAISGSVAHSPPEKLREWLETAGPWGQAAWQDCQGVQGLLAKLLSQLQRFDRTHRCPFPHVVRAGAIFVPIHLVKERLFPRLPPASVDHVL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000032300 92%
Rat ENSRNOG00000018689 88%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.