CacheBy
Atlas Antibodies Anti-C15orf41 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C15orf41 Antibody

상품 한눈에 보기

Human C15orf41 단백질에 특이적인 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. 토끼 유래 IgG 항체이며, 친화 정제 방식으로 제조되었습니다. 인간 시료에 검증되어 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA061023-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061023-100 Anti-C15orf41 Antibody, chromosome 15 open reading frame 41 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061023-25 Anti-C15orf41 Antibody, chromosome 15 open reading frame 41 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C15orf41 Antibody

Anti-C15orf41 Antibody

Target: chromosome 15 open reading frame 41 (C15orf41)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C15orf41 protein.

Alternative Gene Names

FLJ22851, HH114, MGC11326

Open Datasheet (PDF)

Target Information

  • Target Protein: chromosome 15 open reading frame 41
  • Target Gene: C15orf41

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TKAQYDEIAQCLVSVPPTRQSLRKLKQRFPSQSQATLLSIFSQEYQKHIKRTHAKHHTSEAIESYYQRYLNGVVKNGAAPVLLDLA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000040282 95%
Rat ENSRNOG00000004571 94%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.