CacheBy
Atlas Antibodies Anti-C12orf66 Antibody
원본

Atlas Antibodies Anti-C12orf66 Antibody

상품 한눈에 보기

Human C12orf66 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. Rabbit에서 생산된 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 특이적으로 반응하며, 높은 종간 상동성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046743-100 Anti-C12orf66 Antibody, chromosome 12 open reading frame 66 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046743-25 Anti-C12orf66 Antibody, chromosome 12 open reading frame 66 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C12orf66 Antibody

Anti-C12orf66 Antibody

Target: chromosome 12 open reading frame 66 (C12orf66)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C12orf66.

Alternative Gene Names

  • FLJ32549

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein chromosome 12 open reading frame 66
Target Gene C12orf66
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HHPILSPLESSFQLEVDVLCHLLKAQAQVSEWKFLPSLVNLHSAHTKLQTWGQIFEKQRETKKHLFGGQSQKAVQPPHLFLWLMKLKNMLLAKFSF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000028782 (92%)
  • Mouse ENSMUSG00000053684 (92%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.