Atlas Antibodies Anti-C12orf43 Antibody

상품 한눈에 보기

인간 C12orf43 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료, 높은 특이성과 신뢰성 보장. 친화성 정제 및 안정적 PBS/glycerol 버퍼 제공.

카탈로그번호: HPA046148-xxx (2개 옵션)
브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046148-100 Anti-C12orf43 Antibody, chromosome 12 open reading frame 43 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046148-25 Anti-C12orf43 Antibody, chromosome 12 open reading frame 43 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-C12orf43 Antibody

Anti-C12orf43 Antibody

Target: chromosome 12 open reading frame 43
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB) — Recombinant expression validation using target protein overexpression
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C12orf43

Alternative Gene Names: FLJ12448
Target Gene: C12orf43
Target Protein: chromosome 12 open reading frame 43
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

AWGLEQRPHVAGKPRAGAANSQLSTSQPSLRHKVNEHEQDGNELQTTPEFRAHVAKKLGALLDSFITISEAAKEPAKAKVQKVALEDDGFRLFFTSVPGGREKEESPQPR

Verified Species Reactivity

Human

Interspecies Information
Highest antigen sequence identity to orthologs:

Mouse ENSMUSG00000029559 (69%)
Rat ENSRNOG00000001185 (58%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Validation	Recombinant expression validation in WB
Recommended Applications	IHC, WB, ICC
Alternative Gene Names	FLJ12448
Target Gene	C12orf43
Target Protein	chromosome 12 open reading frame 43