CacheBy
Atlas Antibodies Anti-C12orf57 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C12orf57 Antibody

상품 한눈에 보기

Human C12orf57 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조. 인간, 생쥐, 랫드 간 높은 보존성 확인. 안정한 PBS/glycerol buffer 포뮬레이션.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046182-100 Anti-C12orf57 Antibody, chromosome 12 open reading frame 57 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046182-25 Anti-C12orf57 Antibody, chromosome 12 open reading frame 57 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C12orf57 Antibody

Anti-C12orf57 Antibody

Target: chromosome 12 open reading frame 57 (C12orf57)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C12orf57 protein.

Alternative Gene Names

  • C10
  • GRCC10

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein chromosome 12 open reading frame 57
Target Gene C12orf57
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQ
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000050660 (98%)
Mouse ENSMUSG00000072772 (98%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.