
Atlas Antibodies Anti-C12orf57 Antibody
상품 한눈에 보기
Human C12orf57 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. 고순도 Affinity 정제 방식으로 제조. 인간, 생쥐, 랫드 간 높은 보존성 확인. 안정한 PBS/glycerol buffer 포뮬레이션.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C12orf57 Antibody
Target: chromosome 12 open reading frame 57 (C12orf57)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human C12orf57 protein.
Alternative Gene Names
- C10
- GRCC10
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 12 open reading frame 57 |
| Target Gene | C12orf57 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: MASASTQPAALSAEQAKVVLAEVIQAFSAPENAVRMDEARDNACNDMGKMLQFVLPVATQIQQ |
| Verified Species Reactivity | Human |
| Interspecies Homology | Rat ENSRNOG00000050660 (98%) Mouse ENSMUSG00000072772 (98%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C12orf66 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf43 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf57 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf60 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C12orf57 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.