
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C12orf60 Antibody
상품 한눈에 보기
인간 C12orf60 단백질을 인식하는 토끼 폴리클로날 항체입니다. 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. PBS 및 글리세롤 버퍼에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA043911-100 Anti-C12orf60 Antibody, chromosome 12 open reading frame 60 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043911-25 Anti-C12orf60 Antibody, chromosome 12 open reading frame 60 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C12orf60 Antibody
Anti-C12orf60 Antibody
Target Information
- Target Protein: chromosome 12 open reading frame 60
- Target Gene: C12orf60
- Alternative Gene Names: MGC47869
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal antibody against Human C12orf60.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
SSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASD
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000047515 | 48% |
| Rat | ENSRNOG00000027979 | 42% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Usage Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



