CacheBy
Atlas Antibodies Anti-C12orf60 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C12orf60 Antibody

상품 한눈에 보기

인간 C12orf60 단백질을 인식하는 토끼 폴리클로날 항체입니다. 면역세포화학(ICC) 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공합니다. PBS 및 글리세롤 버퍼에 보존되어 안정적입니다.

카탈로그번호
HPA043911-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043911-100 Anti-C12orf60 Antibody, chromosome 12 open reading frame 60 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043911-25 Anti-C12orf60 Antibody, chromosome 12 open reading frame 60 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C12orf60 Antibody

Anti-C12orf60 Antibody

Target Information

  • Target Protein: chromosome 12 open reading frame 60
  • Target Gene: C12orf60
  • Alternative Gene Names: MGC47869

면역세포화학 (ICC)

Product Description

Polyclonal antibody against Human C12orf60.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    SSKTTMIDTLKKLQDVLKTEDSKNPTKSAADLLEQIVKAMGPILEILQKAIKTMEMNISVFKKASD

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000047515 48%
Rat ENSRNOG00000027979 42%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand
Buffer Composition 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Usage Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

Recommended Application - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.