
Atlas Antibodies Anti-C11orf70 Antibody
Human C11orf70 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 정제된 PrEST 항원으로 친화 정제되었습니다. Rabbit 호스트에서 생산되었으며, 인간 반응성 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C11orf70 Antibody
Target: chromosome 11 open reading frame 70
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation (IHC)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.Recombinant expression validation (WB)
Recombinant expression validation in WB using target protein overexpression.ICC
Suitable for immunocytochemistry applications.
Product Description
Polyclonal Antibody against Human C11orf70
Alternative Gene Names: MGC13040
Open Datasheet (PDF)
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 70 |
| Target Gene | C11orf70 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000053070 | 86% |
| Rat | ENSRNOG00000043410 | 86% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C11orf71 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf68 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf63 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf71 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|