CacheBy
Atlas Antibodies Anti-C11orf70 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf70 Antibody

상품 한눈에 보기

Human C11orf70 단백질을 표적으로 하는 고품질 폴리클로날 항체입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, 정제된 PrEST 항원으로 친화 정제되었습니다. Rabbit 호스트에서 생산되었으며, 인간 반응성 검증 완료.

카탈로그번호
HPA038585-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038585-100 Anti-C11orf70 Antibody, chromosome 11 open reading frame 70 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038585-25 Anti-C11orf70 Antibody, chromosome 11 open reading frame 70 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf70 Antibody

Anti-C11orf70 Antibody

Target: chromosome 11 open reading frame 70
Supplier: Atlas Antibodies


  • Orthogonal validation (IHC)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • Recombinant expression validation (WB)
    Recombinant expression validation in WB using target protein overexpression.

  • ICC
    Suitable for immunocytochemistry applications.


Product Description

Polyclonal Antibody against Human C11orf70

Alternative Gene Names: MGC13040
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 70
Target Gene C11orf70
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RLYDEDIVRDSGHIVKCLDSFCDPFLISDELRRVLLVEDSEKYEIFSQPDREEFLFCLFKHLCLGGALCQYEDVIS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000053070 86%
Rat ENSRNOG00000043410 86%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.