
Atlas Antibodies Anti-C11orf63 Antibody
상품 한눈에 보기
인간 C11orf63 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. Affinity purification으로 높은 특이성과 재현성을 보장하며, ICC 등 다양한 응용에 적합합니다. Human 반응성이 검증되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C11orf63 Antibody
Target: chromosome 11 open reading frame 63
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC)
Product Description
Polyclonal Antibody against Human C11orf63
Alternative Gene Names
- FLJ23554
Target Information
- Target Protein: chromosome 11 open reading frame 63
- Target Gene: C11orf63
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence:
MSKRKLIPKLSIQSPVLHTNLNVQSTHPPLKKEDLHRISKDSLESDSESLTQEIMCHSEFDDRIRGNGMEPDSLDEEESPRWG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000032023 | 58% |
| Rat | ENSRNOG00000008138 | 49% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C11orf68 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf63 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf71 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf63 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.