CacheBy
Atlas Antibodies Anti-C11orf68 Antibody
원본

Atlas Antibodies Anti-C11orf68 Antibody

상품 한눈에 보기

Human C11orf68 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. 인체 반응성이 검증되었으며, 높은 종간 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA045938-100 Anti-C11orf68 Antibody, chromosome 11 open reading frame 68 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045938-25 Anti-C11orf68 Antibody, chromosome 11 open reading frame 68 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf68 Antibody

Anti-C11orf68 Antibody

Target: chromosome 11 open reading frame 68
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human C11orf68.


Alternative Gene Names

  • BLES03
  • P5326

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 68
Target Gene C11orf68
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000020551 (98%), Mouse ENSMUSG00000047423 (96%)

Antigen Sequence:
AAWEALQTSGRPITPGTLRQLAITHHVLSGKWLMHLAPGFKLDHAWAGIARAVVEGQLQVAKVSPRAKEGGRQVICVYTD


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.