
Atlas Antibodies Anti-C11orf42 Antibody
Human C11orf42 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량 및 RNA-seq 데이터 기반 직교 검증에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 휴먼 시료에 최적화됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-C11orf42 Antibody
Target: chromosome 11 open reading frame 42 (C11orf42)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human C11orf42.
Alternative Gene Names
- MGC34805
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 42 |
| Target Gene | C11orf42 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence | QLLRLLRSLPVAFSCLKFSLQSKGVLGPQKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPAD |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000030818 | 82% |
| Mouse | ENSMUSG00000078611 | 81% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-C11orf49 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf45 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf42 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-C11orf24 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|