CacheBy
Atlas Antibodies Anti-C11orf42 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf42 Antibody

상품 한눈에 보기

Human C11orf42 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 정량 및 RNA-seq 데이터 기반 직교 검증에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 휴먼 시료에 최적화됨.

카탈로그번호
HPA063404-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063404-100 Anti-C11orf42 Antibody, chromosome 11 open reading frame 42 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063404-25 Anti-C11orf42 Antibody, chromosome 11 open reading frame 42 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf42 Antibody

Anti-C11orf42 Antibody

Target: chromosome 11 open reading frame 42 (C11orf42)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human C11orf42.


Alternative Gene Names

  • MGC34805

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 42
Target Gene C11orf42
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence QLLRLLRSLPVAFSCLKFSLQSKGVLGPQKPLTKDPLPHGANWVRPNLSIMPPLAPTSAPAD

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000030818 82%
Mouse ENSMUSG00000078611 81%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.