CacheBy
Atlas Antibodies Anti-C11orf49 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf49 Antibody

상품 한눈에 보기

Human C11orf49 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. Rabbit 유래 IgG, PrEST 항원으로 정제. 인간에 대한 반응성이 검증되었으며, 높은 종간 서열 유사성을 보임.

카탈로그번호
HPA040051-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040051-100 Anti-C11orf49 Antibody, chromosome 11 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040051-25 Anti-C11orf49 Antibody, chromosome 11 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf49 Antibody

Anti-C11orf49 Antibody

Target: chromosome 11 open reading frame 49 (C11orf49)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression Validation)

Recombinant expression validation:
Validation in WB using target protein overexpression.


Product Description

Polyclonal antibody against human C11orf49.


Alternative Gene Names

  • FLJ22210
  • MGC4707

Open Datasheet


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 49
Target Gene C11orf49
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET
Verified Species Reactivity Human
Interspecies Identity Mouse (90%), Rat (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.