
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C11orf49 Antibody
상품 한눈에 보기
Human C11orf49 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증에 적합. Rabbit 유래 IgG, PrEST 항원으로 정제. 인간에 대한 반응성이 검증되었으며, 높은 종간 서열 유사성을 보임.
- 카탈로그번호
- HPA040051-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040051-100 Anti-C11orf49 Antibody, chromosome 11 open reading frame 49 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040051-25 Anti-C11orf49 Antibody, chromosome 11 open reading frame 49 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C11orf49 Antibody
Anti-C11orf49 Antibody
Target: chromosome 11 open reading frame 49 (C11orf49)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression Validation)
Recombinant expression validation:
Validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human C11orf49.
Alternative Gene Names
- FLJ22210
- MGC4707
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 49 |
| Target Gene | C11orf49 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LGALPDKGDLMHDPAMDEELERLLAQVPGLVNSVTASPEASCLPSRTPPRVGSPWRPLHHSRKVDGESDGSTEETDESET |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (90%), Rat (90%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



