
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-C11orf45 Antibody
상품 한눈에 보기
인간 C11orf45 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료, 친화성 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 항체로 인간 반응성 확인됨.
- 카탈로그번호
- HPA039716-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA039716-100 Anti-C11orf45 Antibody, chromosome 11 open reading frame 45 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039716-25 Anti-C11orf45 Antibody, chromosome 11 open reading frame 45 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-C11orf45 Antibody
Anti-C11orf45 Antibody
Target: chromosome 11 open reading frame 45
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression)
- Recombinant expression validation in WB using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human C11orf45
Alternative Gene Names
FLJ43646, MGC35558
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | chromosome 11 open reading frame 45 |
| Target Gene | C11orf45 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000057701 (32%), Mouse ENSMUSG00000047085 (27%) |
Antigen Sequence:
SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



