CacheBy
Atlas Antibodies Anti-C11orf45 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-C11orf45 Antibody

상품 한눈에 보기

인간 C11orf45 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 재조합 발현 검증 완료, 친화성 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 항체로 인간 반응성 확인됨.

카탈로그번호
HPA039716-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039716-100 Anti-C11orf45 Antibody, chromosome 11 open reading frame 45 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039716-25 Anti-C11orf45 Antibody, chromosome 11 open reading frame 45 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-C11orf45 Antibody

Anti-C11orf45 Antibody

Target: chromosome 11 open reading frame 45
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Recombinant Expression)
    • Recombinant expression validation in WB using target protein overexpression
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human C11orf45

Alternative Gene Names

FLJ43646, MGC35558

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein chromosome 11 open reading frame 45
Target Gene C11orf45
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000057701 (32%), Mouse ENSMUSG00000047085 (27%)

Antigen Sequence:
SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.