CacheBy
Atlas Antibodies Anti-BYSL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BYSL Antibody

상품 한눈에 보기

Human BYSL 단백질을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교를 통한 검증으로 높은 신뢰성 확보. PrEST 항원 기반 친화 정제 및 glycerol/PBS buffer로 안정적 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031219-100 Anti-BYSL Antibody, bystin-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031219-25 Anti-BYSL Antibody, bystin-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BYSL Antibody

Anti-BYSL Antibody

Target Protein: bystin-like
Supplier: Atlas Antibodies

  • IHC (Independent validation by comparing antibodies targeting different epitopes)
  • WB (Independent validation by comparing antibodies targeting different epitopes)
  • ICC

Product Description

Polyclonal antibody against human BYSL.

Open Datasheet

Antigen Information

  • Target Gene: BYSL
  • Antigen Sequence Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE

Verified Species Reactivity

  • Human
  • Mouse

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000049121 91%
Mouse ENSMUSG00000023988 90%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
WB Independent
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.