Atlas Antibodies Anti-BYSL Antibody

상품 한눈에 보기

인간 BYSL 단백질을 표적으로 하는 고품질 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용에 적합하며, 독립 항체 검증으로 높은 신뢰성 제공. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 확보.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031217-100 Anti-BYSL Antibody, bystin-like 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031217-25 Anti-BYSL Antibody, bystin-like 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: bystin-like (BYSL)
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in western blot by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human BYSL.

항목	내용
Target Protein	bystin-like
Target Gene	BYSL
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LDALVFHFLGFRTEKRELPVLWHQCLLTLVQRYKADLATDQKEALLELLRLQPHPQLSPEIRRELQSAVPRDVEDVPITVE
Verified Species Reactivity	Human, Mouse
Interspecies Information	Rat (91%), Mouse (90%) sequence identity
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand