Atlas Antibodies Anti-BZW2 Antibody

상품 한눈에 보기

Human BZW2 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산된 IgG 형식이며, PrEST 항원으로 정제되었습니다. Human, Mouse, Rat에서 반응성이 검증되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022813-100 Anti-BZW2 Antibody, basic leucine zipper and W2 domains 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022813-25 Anti-BZW2 Antibody, basic leucine zipper and W2 domains 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: basic leucine zipper and W2 domains 2
Supplier: Atlas Antibodies

Polyclonal Antibody against Human BZW2

HSPC028, MST017, MSTP017

항목	내용
Target Protein	basic leucine zipper and W2 domains 2
Target Gene	BZW2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Mouse ENSMUSG00000020547 (100%), Rat ENSRNOG00000005096 (99%)

Antigen Sequence:

GLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVKEEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELV

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand