
Atlas Antibodies Anti-BRMS1L Antibody
상품 한눈에 보기
인체 BRMS1L 단백질을 인식하는 폴리클로날 항체로, 유방암 전이 억제 단백질 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 다양한 실험 응용에 사용할 수 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BRMS1L Antibody
Target: breast cancer metastasis-suppressor 1-like (BRMS1L)
Supplier: Atlas Antibodies
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human BRMS1L.
Alternative Gene Names
- BRMS1
- FLJ39177
- MGC11296
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | breast cancer metastasis-suppressor 1-like |
| Target Gene | BRMS1L |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000051077 | 100% |
| Mouse | ENSMUSG00000012076 | 99% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BRMS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRMS1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRIX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRINP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.