CacheBy
Atlas Antibodies Anti-BRMS1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRMS1L Antibody

상품 한눈에 보기

인체 BRMS1L 단백질을 인식하는 폴리클로날 항체로, 유방암 전이 억제 단백질 연구에 적합합니다. 토끼에서 생산된 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. 인간에 대한 반응성이 검증되었으며, 다양한 실험 응용에 사용할 수 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA046623-100 Anti-BRMS1L Antibody, breast cancer metastasis-suppressor 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046623-25 Anti-BRMS1L Antibody, breast cancer metastasis-suppressor 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRMS1L Antibody

Anti-BRMS1L Antibody

Target: breast cancer metastasis-suppressor 1-like (BRMS1L)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human BRMS1L.


Alternative Gene Names

  • BRMS1
  • FLJ39177
  • MGC11296

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein breast cancer metastasis-suppressor 1-like
Target Gene BRMS1L
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence EDWTTIRKAMATLGPHRVKTEPPVKLEKHLHSARSEEGRLYYDGEWYIRGQTICIDKKDECPTSAVITTINHDEVWFKRPDGSKSK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000051077 100%
Mouse ENSMUSG00000012076 99%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.