Atlas Antibodies Anti-BRIX1 Antibody

상품 한눈에 보기

Human BRIX1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. BRIX, BXDC2, FLJ11100 등의 유전자명으로도 알려진 BRIX1 단백질 검출에 사용됩니다. 친화정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039614-100 Anti-BRIX1 Antibody, BRX1, biogenesis of ribosomes, homolog (S. cerevisiae) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039614-25 Anti-BRIX1 Antibody, BRX1, biogenesis of ribosomes, homolog (S. cerevisiae) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Supplier: Atlas Antibodies

Polyclonal antibody against Human BRIX1.

BRIX, BXDC2, FLJ11100

항목	내용
Target Protein	BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Target Gene	BRIX1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Identity	Rat ENSRNOG00000018021 (95%), Mouse ENSMUSG00000022247 (94%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet