
Atlas Antibodies Anti-BRIX1 Antibody
상품 한눈에 보기
Human BRIX1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. BRIX, BXDC2, FLJ11100 등의 유전자명으로도 알려진 BRIX1 단백질 검출에 사용됩니다. 친화정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-BRIX1 Antibody
Target: BRX1, biogenesis of ribosomes, homolog (S. cerevisiae)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human BRIX1.
Alternative Gene Names
BRIX, BXDC2, FLJ11100
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BRX1, biogenesis of ribosomes, homolog (S. cerevisiae) |
| Target Gene | BRIX1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000018021 (95%), Mouse ENSMUSG00000022247 (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-BRK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRMS1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRIX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRINP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-BRIP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.