CacheBy
Atlas Antibodies Anti-BRMS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-BRMS1 Antibody

상품 한눈에 보기

Human BRMS1 단백질을 인식하는 폴리클로날 항체로, 유방암 전이 억제 연구에 적합합니다. WB 및 ICC 응용에 추천되며, 토끼 유래 IgG 형태입니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA019637-100 Anti-BRMS1 Antibody, breast cancer metastasis suppressor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019637-25 Anti-BRMS1 Antibody, breast cancer metastasis suppressor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-BRMS1 Antibody

Anti-BRMS1 Antibody

Target: Breast Cancer Metastasis Suppressor 1 (BRMS1)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human BRMS1 protein, designed for research use in cancer metastasis studies.


Alternative Gene Names

  • DKFZP564A063

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Breast cancer metastasis suppressor 1
Target Gene BRMS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK

Species Reactivity

  • Verified: Human
  • Interspecies Identity:
    • Rat (ENSRNOG00000047683): 93%
    • Mouse (ENSMUSG00000080268): 89%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Affinity purified using PrEST antigen
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

WB Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.