
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BRMS1 Antibody
상품 한눈에 보기
Human BRMS1 단백질을 인식하는 폴리클로날 항체로, 유방암 전이 억제 연구에 적합합니다. WB 및 ICC 응용에 추천되며, 토끼 유래 IgG 형태입니다. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA019637-100 Anti-BRMS1 Antibody, breast cancer metastasis suppressor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA019637-25 Anti-BRMS1 Antibody, breast cancer metastasis suppressor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BRMS1 Antibody
Anti-BRMS1 Antibody
Target: Breast Cancer Metastasis Suppressor 1 (BRMS1)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human BRMS1 protein, designed for research use in cancer metastasis studies.
Alternative Gene Names
- DKFZP564A063
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Breast cancer metastasis suppressor 1 |
| Target Gene | BRMS1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KLLLYDTLQGELQERIQRLEEDRQSLDLSSEWWDDKLHARGSSRSWDSLPPSKRKKAPLVSGPYIVYMLQEIDILEDWTAIKKARAAVSPQK |
Species Reactivity
- Verified: Human
- Interspecies Identity:
- Rat (ENSRNOG00000047683): 93%
- Mouse (ENSMUSG00000080268): 89%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



