
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BRCA1 Antibody
상품 한눈에 보기
Human BRCA1 단백질을 인식하는 토끼 폴리클로날 항체로, DNA 손상 복구 연구에 적합합니다. IHC 기반 정교한 Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA057371-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057371-100 Anti-BRCA1 Antibody, BRCA1, DNA repair associated 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057371-25 Anti-BRCA1 Antibody, BRCA1, DNA repair associated 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BRCA1 Antibody
Anti-BRCA1 Antibody
Target: BRCA1, DNA repair associated
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human BRCA1.
Alternative Gene Names
BRCC1, FANCS, PPP1R53, RNF53
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BRCA1, DNA repair associated |
| Target Gene | BRCA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVHPIVVVQPDA |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020701 (68%), Mouse ENSMUSG00000017146 (65%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



