
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-BRAT1 Antibody
상품 한눈에 보기
인간 BRAT1 단백질을 인식하는 토끼 폴리클로날 항체로, BRCA1-associated ATM activator 1 검출에 사용됩니다. IHC 및 WB에 적합하며, 재조합 발현 검증 완료. 고순도 Affinity 정제 및 안정한 PBS/glycerol buffer 구성.
- 카탈로그번호
- HPA029455-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029455-100 Anti-BRAT1 Antibody, BRCA1-associated ATM activator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029455-25 Anti-BRAT1 Antibody, BRCA1-associated ATM activator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-BRAT1 Antibody
Anti-BRAT1 Antibody
Target: BRCA1-associated ATM activator 1 (BRAT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, recombinant expression validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against human BRAT1.
Alternative Gene Names
BAAT1, C7orf27, MGC22916
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | BRCA1-associated ATM activator 1 |
| Target Gene | BRAT1 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (79%), Rat (79%) |
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
LLDWFKTVTEGESSVVLLQEHPCLVELLSHVLKVQDLSSGVLSFSLRLAGTFAAQENCFQYLQQGELLPGLFGEPG
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



